HAT1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HAT1 Recombinant monoclonal antibody, PBS Only (86815-1-PBS)

• 

  WB analysis using 86815-1-RR (same clone as 86815-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86815-1-RR (HAT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86815-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86815-1-RR (same clone as 86815-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HAT1 antibody (86815-1-RR, Clone: 251855A12 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86815-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 86815-1-RR (same clone as 86815-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using HAT1 antibody (86815-1-RR, Clone: 251855A12 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86815-1-PBS in a different storage buffer formulation.

HAT1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86815-1-PBS

Clone No.251855A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:2.3.1.48, KAT1

---

Product Information

86815-1-PBS targets HAT1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1952

  Product name: Recombinant human HAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-419 aa of BC018682

  Sequence: MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE

• Full Name: histone acetyltransferase 1
• Calculated Molecular Weight: 419 aa, 50 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC018682
• Gene Symbol: HAT1
• Gene ID (NCBI): 8520
• RRID: AB_3745139
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14929
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.