HBD Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HBD Polyclonal antibody, PBS Only (16824-1-PBS)

• 

  WB analysis of human plasma using 16824-1-AP (same clone as 16824-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 16824-1-AP (HBD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16824-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 16824-1-AP (same clone as 16824-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 16824-1-AP (HBD antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16824-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16824-1-AP (same clone as 16824-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 16824-1-AP (HBD antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16824-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16824-1-AP (same clone as 16824-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 16824-1-AP (HBD antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16824-1-PBS in a different storage buffer formulation.

HBD Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16824-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Delta globin, Delta-globin, Hemoglobin delta chain, Hemoglobin subunit delta, hemoglobin, delta

---

Product Information

16824-1-PBS targets HBD in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10409

  Product name: Recombinant human HBD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC070282

  Sequence: MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

• Full Name: hemoglobin, delta
• Calculated Molecular Weight: 147 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC070282
• Gene Symbol: HBD
• Gene ID (NCBI): 3045
• RRID: AB_2114476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02042
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.