HCFC1 Polyclonal antibody

HCFC1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 28569-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

HCF C-terminal chain 2, HCF C-terminal chain 1, HCF 1, HCF, CFF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, K-562 cells, NIH/3T3 cells, PC-12 cells, C2C12 cells, C6 cells
Positive IP detected inHeLa cells
Positive IHC detected inmouse liver tissue, human lung cancer tissue, human urothelial carcinoma tissue, mouse cerebellum tissue, mouse lung tissue, mouse skin tissue, rat cerebellum tissue, rat lung tissue, rat skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28569-1-AP targets HCFC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29663

Product name: Recombinant human HCFC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1018-1174 aa of NM_005334

Sequence: CETHETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRISVATGALEAAQGSKSQCQTRQTSAT

Predict reactive species
Full Name host cell factor C1 (VP16-accessory protein)
Calculated Molecular Weight 209 kDa
Observed Molecular Weight300 kDa, 100-150 kDa
GenBank Accession NumberNM_005334
Gene Symbol HCFC1
Gene ID (NCBI) 3054
RRIDAB_3086066
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51610
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HCFC1 (also known as HCF-1) was discovered in studies of herpes simplex virus (HSV) transcription. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in the control of the cell cycle and transcriptional regulation during herpes simplex virus infection. HCFC1 is a large protein of ∼300 kDa and is proteolytically processed into N- and C-terminal fragments of ∼150 kDa each.(PMID: 21295698 )

Protocols

Product Specific Protocols
IF protocol for HCFC1 antibody 28569-1-APDownload protocol
IHC protocol for HCFC1 antibody 28569-1-APDownload protocol
IP protocol for HCFC1 antibody 28569-1-APDownload protocol
WB protocol for HCFC1 antibody 28569-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...