HCFC1 Polyclonal antibody

• 

  WB analysis using 28569-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28569-1-AP (HCFC1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 28569-1-AP

  IP result of anti-HCFC1 (IP:28569-1-AP, 4ug; Detection:28569-1-AP 1:20000) with HeLa cells lysate 1600 ug.

• 

  IHC staining of mouse liver using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skin using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skin using 28569-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 28569-1-AP (HCFC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 28569-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HCFC1 antibody (28569-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

HCFC1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 28569-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

HCF C-terminal chain 2, HCF C-terminal chain 1, HCF 1, HCF, CFF

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, NIH/3T3 cells, PC-12 cells, C2C12 cells, C6 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse liver tissue, human lung cancer tissue, human urothelial carcinoma tissue, mouse cerebellum tissue, mouse lung tissue, mouse skin tissue, rat cerebellum tissue, rat lung tissue, rat skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28569-1-AP targets HCFC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29663

  Product name: Recombinant human HCFC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1018-1174 aa of NM_005334

  Sequence: CETHETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRISVATGALEAAQGSKSQCQTRQTSAT

• Full Name: host cell factor C1 (VP16-accessory protein)
• Calculated Molecular Weight: 209 kDa
• Observed Molecular Weight: 300 kDa, 100-150 kDa
• GenBank Accession Number: NM_005334
• Gene Symbol: HCFC1
• Gene ID (NCBI): 3054
• RRID: AB_3086066
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51610
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HCFC1 (also known as HCF-1) was discovered in studies of herpes simplex virus (HSV) transcription. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in the control of the cell cycle and transcriptional regulation during herpes simplex virus infection. HCFC1 is a large protein of ∼300 kDa and is proteolytically processed into N- and C-terminal fragments of ∼150 kDa each.(PMID: 21295698 )