CoraLite® Plus 488-conjugated HDAC5 Polyclonal antibody

HDAC5 Polyclonal Antibody for IF/ICC
Cat No. CL488-29342

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IF/ICC

Antigen NY CO 9, FLJ90614, HD5, HDAC, HDAC5, histone deacetylase 5, KIAA0600, NY CO 9

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-29342 targets HDAC5 in IF/ICC applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29122

Product name: Recombinant human HDAC5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 557-682 aa of NM_005474

Sequence: TEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFT

Predict reactive species
Full Name histone deacetylase 5
Calculated Molecular Weight 122 kDa
Observed Molecular Weight120-140 kDa
GenBank Accession NumberNM_005474
Gene Symbol HDAC5
Gene ID (NCBI) 10014
RRIDAB_3672838
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UQL6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Histone acetylation and deacetylation alternately exposes and occludes DNA to transcription factors. At least 4 classes of HDAC were identified. HDAC5 is a class II HDAC. HDAC5 responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC5 is involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, HDAC5 shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HDAC5 antibody CL488-29342Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...