HDHD1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HDHD1A Polyclonal antibody, PBS Only (33953-1-PBS)

• 

  WB analysis using 33953-1-AP (same clone as 33953-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33953-1-AP (HDHD1A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33953-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Caco-2 using 33953-1-AP (same clone as 33953-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed Caco-2 cells using HDHD1A antibody (33953-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 33953-1-PBS in a different storage buffer formulation.

HDHD1A Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 33953-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

5'-PsiMPase, DXF68S1E, EC:3.1.3.96, FAM16AX, GS1

---

Product Information

33953-1-PBS targets HDHD1A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40679

  Product name: Recombinant human HDHD1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of BC012494

  Sequence: MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE

• Full Name: haloacid dehalogenase-like hydrolase domain containing 1A
• Calculated Molecular Weight: 228 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC012494
• Gene Symbol: HDHD1A
• Gene ID (NCBI): 8226
• RRID: AB_3743122
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q08623
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The enzyme encoded by human HDHD1A (hHDHD1A; also known as HDHD1, PUDP, GS1; Gene ID: 8226) has activity specific for ΨMP 5'-phosphatase (PMID: 20722631). HDHD1A belongs to the HAD-like hydrolase superfamily. In humans, the enzyme HDHD1A dephosphorylates pseudouridine 5'-monophosphate (ΨMP), and the resulting Ψ is excreted in the urine (PMID: 40409548).