HE4 Monoclonal antibody, PBS Only (Capture)

HE4 Monoclonal Antibody for IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 66557-1-PBS
Clone No.5B2D9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, IF/ICC, Cytometric bead array, Indirect ELISA

WFDC2, 5B2D9, Epididymal secretory protein E4, Major epididymis-specific protein E4, WAP four disulfide core domain protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66557-1-PBS targets HE4 as part of a matched antibody pair:

MP51083-2: 66557-1-PBS capture and 66557-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5936

Product name: Recombinant human HE4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 21-124 aa of BC046106

Sequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Predict reactive species
Full Name WAP four-disulfide core domain 2
Calculated Molecular Weight 13 kDa
GenBank Accession NumberBC046106
Gene Symbol HE4
Gene ID (NCBI) 10406
RRIDAB_2881918
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14508
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

WFDC2, also named as HE4, is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. HE4 is expressed in a number of normal tissues, and it is also highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. In some study, HE4 was referred to as a biomarker for ovarian carcinoma.

Loading...
||
New chat

Able

正在加载,请稍候...