Tested Applications
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SKOV-3 cells |
| Positive FC (Intra) detected in | SKOV-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:1000-1:5000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66557-1-Ig targets HE4/WFDC2 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5936 Product name: Recombinant human HE4/WFDC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 21-124 aa of BC046106 Sequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF Predict reactive species |
| Full Name | WAP four-disulfide core domain 2 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | BC046106 |
| Gene Symbol | HE4 |
| Gene ID (NCBI) | 10406 |
| RRID | AB_2881918 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14508 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WFDC2, also named as HE4, is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. HE4 is expressed in a number of normal tissues, and it is also highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. In some study, HE4 was referred to as a biomarker for ovarian carcinoma.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for HE4/WFDC2 antibody 66557-1-Ig | Download protocol |
| IF protocol for HE4/WFDC2 antibody 66557-1-Ig | Download protocol |
| IHC protocol for HE4/WFDC2 antibody 66557-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HE4/WFDC2 Monoclonal antibody (5B2D9), catalog number 66557-1-Ig, has 2 total citations. These appear in Oncol Res and iScience. Both studies focus on ovarian cancer research—one investigating HE4's role in extracellular matrix remodeling via fibroblast activation (IHC), and the other examining a late-stage autophagy inhibitor that reverses chemoresistance and promotes apoptosis in ovarian cancer (IF). The antibody was used in human samples in both studies.
| Species | Application | Title |
|---|---|---|
Oncol Res HE4 Might Participate in Extracellular Matrix Remodeling in Ovarian Cancer via Activation of Fibroblasts.
| ||
iScience Erythrabyssin ll is identified as a late-stage autophagy inhibitor reversing chemoresistance and promoting apoptosis in ovarian cancer. |
