HE4 Monoclonal antibody

• 

  IHC staining of human ovary tumor using 66557-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66557-1-Ig (HE4 antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 66557-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66557-1-Ig (HE4 antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SKOV-3 using 66557-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed SKOV-3 cells using HE4 antibody (66557-1-Ig, Clone: 5B2D9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

HE4 Monoclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 66557-1-Ig

Clone No.5B2D9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

WFDC2, 5B2D9, Epididymal secretory protein E4, Major epididymis-specific protein E4, WAP four disulfide core domain protein 2

---

Tested Applications

• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SKOV-3 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:5000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66557-1-Ig targets HE4 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5936

  Product name: Recombinant human HE4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 21-124 aa of BC046106

  Sequence: GFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

• Full Name: WAP four-disulfide core domain 2
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC046106
• Gene Symbol: HE4
• Gene ID (NCBI): 10406
• RRID: AB_2881918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14508
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WFDC2, also named as HE4, is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. HE4 is expressed in a number of normal tissues, and it is also highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. In some study, HE4 was referred to as a biomarker for ovarian carcinoma.