HEATR2 Polyclonal antibody

• 

  WB analysis using 24578-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24578-1-AP (HEATR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 24578-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 24578-1-AP (HEATR2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 24578-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using HEATR2 antibody (24578-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

HEATR2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24578-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HEAT repeat-containing protein 2, HEAT repeat containing 2, Dynein axonemal assembly factor 5, DNAAF5

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

24578-1-AP targets HEATR2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20080

  Product name: Recombinant human HEATR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 661-809 aa of BC047240

  Sequence: NLQWHAGRTAAAIRTAAVSCLWALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEKLIRIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLDDPERAIQDAI

• Full Name: HEAT repeat containing 2
• Calculated Molecular Weight: 855 aa, 94 kDa
• Observed Molecular Weight: 93 kDa
• GenBank Accession Number: BC047240
• Gene Symbol: HEATR2
• Gene ID (NCBI): 54919
• RRID: AB_2827668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86Y56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HEATR2 also termed as HEAT repeat containing 2 is an 855 amino acid protein. HEATR2 is a member of a family of ten other uncharacterized HEAT-repeat-containing proteins, which contains HEAT (Huntingtin, elongation factor 3 (EF3), protein phosphatase 2A (PP2A) and the yeast PI3-kinase Tor1) repeats. HEAT repeats form rod-like helical structures that are involved in intracellular transport. HEATR2 play an important role in dynein arm transportation or assembly. HEATR2 mutation is implicated in Primary ciliary dyskinesia 18.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; DNA Methylation Regulates Alternative Polyadenylation via CTCF and the Cohesin Complex.; Authors - Vishal Nanavaty
rat,human	WB, IF	PLoS Genet; HEATR2 Plays a Conserved Role in Assembly of the Ciliary Motile Apparatus.; Authors - Christine P Diggle
human	WB	Front Oncol; DNAAF5 promotes hepatocellular carcinoma malignant progression by recruiting USP39 to improve PFKL protein stability; Authors - Yaping Liu