HEATR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HEATR2 Polyclonal antibody (24578-1-AP)

HEATR2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24578-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

DNAAF5, Dynein axonemal assembly factor 5, HEAT repeat containing 2, HEAT repeat-containing protein 2

• 

  WB analysis using 24578-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24578-1-AP (HEATR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 24578-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 24578-1-AP (HEATR2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HEATR2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24578-1-AP targets HEATR2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20080

  Product name: Recombinant human HEATR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 661-809 aa of BC047240

  Sequence: NLQWHAGRTAAAIRTAAVSCLWALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEKLIRIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLDDPERAIQDAI

• Full Name: HEAT repeat containing 2
• Calculated Molecular Weight: 855 aa, 94 kDa
• Observed Molecular Weight: 93 kDa
• GenBank Accession Number: BC047240
• Gene Symbol: HEATR2
• Gene ID (NCBI): 54919
• RRID: AB_2827668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86Y56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HEATR2 also termed as HEAT repeat containing 2 is an 855 amino acid protein. HEATR2 is a member of a family of ten other uncharacterized HEAT-repeat-containing proteins, which contains HEAT (Huntingtin, elongation factor 3 (EF3), protein phosphatase 2A (PP2A) and the yeast PI3-kinase Tor1) repeats. HEAT repeats form rod-like helical structures that are involved in intracellular transport. HEATR2 play an important role in dynein arm transportation or assembly. HEATR2 mutation is implicated in Primary ciliary dyskinesia 18.

Publications

What published studies show

The HEATR2 Polyclonal antibody (Cat# 24578-1-AP) has 3 citations. These appear in Molecular Cell, PLoS Genetics, and Frontiers in Oncology. The research fields span DNA methylation regulation of alternative polyadenylation via CTCF and cohesin, ciliary motile apparatus assembly, and hepatocellular carcinoma malignant progression involving PFKL protein stability.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; DNA Methylation Regulates Alternative Polyadenylation via CTCF and the Cohesin Complex.; Authors - Vishal Nanavaty
rat,human	WB,IF	PLoS Genet; HEATR2 Plays a Conserved Role in Assembly of the Ciliary Motile Apparatus.; Authors - Christine P Diggle
human	WB	Front Oncol; DNAAF5 promotes hepatocellular carcinoma malignant progression by recruiting USP39 to improve PFKL protein stability; Authors - Yaping Liu