HEATR4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HEATR4 Polyclonal antibody, PBS Only (23944-1-PBS)

• 

  IHC staining of human testis using 23944-1-AP (same clone as 23944-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis slide using 23944-1-AP (HEATR4 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23944-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 23944-1-AP (same clone as 23944-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis slide using 23944-1-AP (HEATR4 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23944-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 23944-1-AP (same clone as 23944-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23944-1-AP (HEATR4 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23944-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 23944-1-AP (same clone as 23944-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23944-1-AP (HEATR4 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23944-1-PBS in a different storage buffer formulation.

HEATR4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 23944-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

23944-1-PBS targets HEATR4 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21056

  Product name: Recombinant human HEATR4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 630-979 aa of BC047590

  Sequence: NKEVRRAAAQALGQMSLGKEVHDIIRVKLGQGNSQERVEALYLIGELKLMTAKLLPSFLHCFSDDFTAVRRAACLAAGALQIRDKMVLECLLNLMQRDPYWKIKAFAIRALGQIGQVSPELTDLLLWAIHYEESPGVRLEACRSILALKLQGDRVRDTFLDVLLLENHDAVLKEMYQTMKILNLGNEGNQEMLQEIKNRIKTLSQKDLLTHKILKLEMVMGKVREEAKRVYLKPKGEQGPLTLQTLLQETFQDEMVLPRRPSEVCDTEAVIKPVKPRAPNPWLQSSVPGLTTRSKVRSSLVKDLRTSPEKRIAVGPFRSDYPALYLGKFSERTFFSPIMSSPSGKKGAHL

• Full Name: HEAT repeat containing 4
• Calculated Molecular Weight: 1026 aa, 117 kDa
• GenBank Accession Number: BC047590
• Gene Symbol: HEATR4
• Gene ID (NCBI): 399671
• RRID: AB_2879370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q86WZ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.