HEBP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82950-1-RR (same clone as 82950-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82950-1-RR (HEBP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82950-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 82950-1-RR (same clone as 82950-1-PBS)

  WB result of HEBP1 antibody (82950-1-RR; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-HEBP1 transfected A549 cells. This data was developed using the same antibody clone with 82950-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 82950-1-RR (same clone as 82950-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 82950-1-RR (HEBP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82950-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 82950-1-RR (same clone as 82950-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 82950-1-RR (HEBP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82950-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 82950-1-RR (same clone as 82950-1-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug HEBP1 Recombinant antibody (82950-1-RR, Clone:230156B6) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82950-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82950-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82950-1-RR against Human HEBP1 were performed. The affinity constant is 25.2 nM.

• Featured Product
• KD/KO Validated

HEBP1 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 82950-1-PBS

Clone No.230156B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

230156B6, HBP, HEBP, HEBP 1, heme binding protein 1

---

Product Information

82950-1-PBS targets HEBP1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10538

  Product name: Recombinant human HEBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC016277

  Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT

• Full Name: heme binding protein 1
• Calculated Molecular Weight: 189 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC016277
• Gene Symbol: HEBP1
• Gene ID (NCBI): 50865
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRV9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.