• Featured Product
  • KD/KO Validated

HEBP1 Recombinant monoclonal antibody

HEBP1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 82950-1-RR
Clone No.230156B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

230156B6, HBP, HEBP, HEBP 1, heme binding protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells, L02 cells, HepG2 cells, rat liver tissue. mouse liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82950-1-RR targets HEBP1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10538

Product name: Recombinant human HEBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-189 aa of BC016277

Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT

Predict reactive species
Full Name heme binding protein 1
Calculated Molecular Weight 189 aa, 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC016277
Gene Symbol HEBP1
Gene ID (NCBI) 50865
RRIDAB_3670693
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRV9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
FC protocol for HEBP1 antibody 82950-1-RRDownload protocol
IHC protocol for HEBP1 antibody 82950-1-RRDownload protocol
WB protocol for HEBP1 antibody 82950-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...