Home
Products
Primary Antibodies
HECTD1 Polyclonal antibody, PBS Only (20605-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis using 20605-1-AP (same clone as 20605-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 20605-1-AP (HECTD1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
WB analysis of human brain using 20605-1-AP (same clone as 20605-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 20605-1-AP (HECTD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
WB analysis of human brain using 20605-1-AP (same clone as 20605-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 20605-1-AP (HECTD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20605-1-AP (same clone as 20605-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20605-1-AP (HECTD1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20605-1-AP (same clone as 20605-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20605-1-AP (HECTD1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20605-1-AP (same clone as 20605-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 20605-1-AP (HECTD1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20605-1-AP (same clone as 20605-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 20605-1-AP (HECTD1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 20605-1-AP (same clone as 20605-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 20605-1-AP (HECTD1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 20605-1-AP (same clone as 20605-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 20605-1-AP (HECTD1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 20605-1-AP (same clone as 20605-1-PBS)
Immunofluorescent analysis of Hela cells, using HECTD1 antibody 20605-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 20605-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

HECTD1 Polyclonal antibody, PBS Only

Name: HECTD1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 20605-1-PBS

HECTD1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20605-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

20605-1-PBS targets HECTD1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14581 Product name: Recombinant human HECTD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-121 aa of BC006237 Sequence: PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN Predict reactive species
Full Name	HECT domain containing 1
Calculated Molecular Weight	2612 aa, 290 kDa
Observed Molecular Weight	290 kDa
GenBank Accession Number	BC006237
Gene Symbol	HECTD1
Gene ID (NCBI)	25831
RRID	AB_10732804
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9ULT8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

HECTD1 (E3 ubiquitin-protein ligase), which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates,may be required for development of the head mesenchyme and neural tube closure.It is also involved in sporadic Parkinson's disease(PMID:16714300).This protein is specific to HECTD1.