HECW1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HECW1 Polyclonal antibody, PBS Only (24695-1-PBS)

• 

  IHC staining of human urothelial carcinoma using 24695-1-AP (same clone as 24695-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24695-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 24695-1-AP (same clone as 24695-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24695-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 24695-1-AP (same clone as 24695-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24695-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 24695-1-AP (same clone as 24695-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24695-1-PBS in a different storage buffer formulation.

HECW1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24695-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

24695-1-PBS targets HECW1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20264

  Product name: Recombinant human HECW1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC151227

  Sequence: MLLHLCSVKNLYQNRFLGLAAMASPSRNSQSRRRCKEPLRYSYNPDQFHNMDLRGGPHDGVTIPRSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIDEVLSENFLDYKNRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVTVKNSAAPIFKSIGADETVQGQGSRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSIFPALPHHGQERRSKIIGNTVNPIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGKLSMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDD

• Full Name: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
• Calculated Molecular Weight: 1606 aa, 180 kDa
• GenBank Accession Number: BC151227
• Gene Symbol: HECW1
• Gene ID (NCBI): 23072
• RRID: AB_2918085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q76N89
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.