HEPACAM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HEPACAM Polyclonal antibody, PBS Only (18177-1-PBS)

• 

  WB analysis of mouse brain using 18177-1-AP (same clone as 18177-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18177-1-AP (HEPACAM antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18177-1-AP (same clone as 18177-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18177-1-AP (HEPACAM antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18177-1-AP (same clone as 18177-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18177-1-AP (HEPACAM antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 18177-1-AP (same clone as 18177-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18177-1-AP (HEPACAM Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 18177-1-AP (same clone as 18177-1-PBS)

  IP result of anti-HEPACAM (IP:18177-1-AP, 4ug; Detection:18177-1-AP 1:500) with rat brain tissue lysate 4000ug. This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 18177-1-AP (same clone as 18177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18177-1-AP (HEPACAM antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 18177-1-AP (same clone as 18177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18177-1-AP (HEPACAM antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 18177-1-AP (same clone as 18177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 18177-1-AP (HEPACAM antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 18177-1-AP (same clone as 18177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 18177-1-AP (HEPACAM antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18177-1-AP (same clone as 18177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18177-1-AP (HEPACAM Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18177-1-AP (same clone as 18177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18177-1-AP (HEPACAM Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 18177-1-AP (same clone as 18177-1-PBS)

  mmunofluorescent analysis of MCF-7 cells, using HEPACAM antibody 18177-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 18177-1-PBS in a different storage buffer formulation.

HEPACAM Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 18177-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

glialCAM, Hepatic and glial cell adhesion molecule, Protein hepaCAM

---

Product Information

18177-1-PBS targets HEPACAM in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12870

  Product name: Recombinant human HEPACAM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-242 aa of BC104831

  Sequence: ITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCVVENPISQGRSLPVKITVYRRSSLY

• Full Name: hepatocyte cell adhesion molecule
• Calculated Molecular Weight: 416 aa, 46 kDa
• Observed Molecular Weight: 46-72 kDa
• GenBank Accession Number: BC104831
• Gene Symbol: HEPACAM
• Gene ID (NCBI): 220296
• RRID: AB_2279680
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14CZ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HepaCAM (hepatocyte cell adhesion molecule), also known as GlialCAM, is a single-pass type I membrane glycoprotein of 416 amino acids. It displays a typical structure of immunoglobulin (Ig)-like adhesion molecules including two extracellular Ig-like domains, a transmembrane segment, and a cytoplasmic tail. It has been shown that hepaCAM forms a cis-homodimer on the cell surface, and modulates cell-matrix interaction. It is predominantly expressed in the CNS glial cells. Defects in HEPACAM gene are the cause of megalencephalic leukoencephalopathy with subcortical cysts type 2A (MLC2A). HEPACAM has also been suggested as a tumor suppressor gene.