HERC5 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HERC5 Recombinant monoclonal antibody (87166-1-RR)

• 

  WB analysis using 87166-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87166-1-RR (HERC5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 87166-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using HERC5 antibody (87166-1-RR, Clone: 252294E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

HERC5 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87166-1-RR

Clone No.252294E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CEB1, CEBP1, Cyclin E binding protein 1, Cyclin-E-binding protein 1, E3 ISG15 protein ligase HERC5

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A549 cells, Jurkat cells, U-251 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87166-1-RR targets HERC5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33511

  Product name: Recombinant human HERC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 160-342 aa of BC140716

  Sequence: FAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNSTQNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPV

• Full Name: hect domain and RLD 5
• Calculated Molecular Weight: 1024 aa, 117 kDa
• Observed Molecular Weight: 117 kDa
• GenBank Accession Number: BC140716
• Gene Symbol: HERC5
• Gene ID (NCBI): 51191
• RRID: AB_3745382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UII4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HERC5 (HECT and RLD domain-containing E3 ubiquitin ligase 5) is constitutively expressed at low or undetectable levels in most normal adult tissues and in a subset of cancer cell lines. It is an evolutionarily ancient restriction factor that inhibits the replication of diverse viruses. By virtue of its C-terminal HECT domain, HERC5 is the main cellular E3 ligase for conjugating ISG15 to substrates and localizes to polyribosomes to modify newly translated viral proteins, thereby disrupting key aspects of viral particle production. E3 ligase-independent antiviral activity has also been demonstrated towards HIV-1, where it inhibits the nuclear export of incompletely-spliced viral RNAs by a mechanism requiring its N-terminal RCC1-like domain (RLD). (PMID: 34572049)