Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated HERC5 Recombinant monoclonal antibody

HERC5 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-87166
Clone No.252294E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

CEB1, CEBP1, Cyclin E binding protein 1, Cyclin-E-binding protein 1, E3 ISG15 protein ligase HERC5

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-87166 targets HERC5 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33511

Product name: Recombinant human HERC5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 160-342 aa of BC140716

Sequence: FAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNSTQNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPV

Predict reactive species
Full Name hect domain and RLD 5
Calculated Molecular Weight 1024 aa, 117 kDa
Observed Molecular Weight117 kDa
GenBank Accession NumberBC140716
Gene Symbol HERC5
Gene ID (NCBI) 51191
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UII4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HERC5 (HECT and RLD domain-containing E3 ubiquitin ligase 5) is constitutively expressed at low or undetectable levels in most normal adult tissues and in a subset of cancer cell lines. It is an evolutionarily ancient restriction factor that inhibits the replication of diverse viruses. By virtue of its C-terminal HECT domain, HERC5 is the main cellular E3 ligase for conjugating ISG15 to substrates and localizes to polyribosomes to modify newly translated viral proteins, thereby disrupting key aspects of viral particle production. E3 ligase-independent antiviral activity has also been demonstrated towards HIV-1, where it inhibits the nuclear export of incompletely-spliced viral RNAs by a mechanism requiring its N-terminal RCC1-like domain (RLD). (PMID: 34572049)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HERC5 antibody CL488-87166Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...