HFE2/Hemojuvelin Recombinant monoclonal antibody

• 

  WB analysis using 86775-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86775-3-RR (HFE2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 86775-3-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using HFE2 antibody (86775-3-RR, Clone: 251477G9 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 86775-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86775-3-RR against Human HFE2 were performed. The affinity constant is below 1 pM.

HFE2/Hemojuvelin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86775-3-RR

Clone No.251477G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Hemojuvelin, HFE2, Hemochromatosis type 2 protein, Hemojuvelin BMP coreceptor, HFE2A

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells, human platelets, human skeletal muscle tissue, human heart tissue, mouse liver tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86775-3-RR targets HFE2/Hemojuvelin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2354

  Product name: Recombinant human HFE2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 227-426 aa of BC017926

  Sequence: MQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ

• Full Name: hemochromatosis type 2 (juvenile)
• Calculated Molecular Weight: 426 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC017926
• Gene Symbol: HFE2
• Gene ID (NCBI): 148738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6ZVN8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HFE2, also known as Hemojuvelin (HJV), is a GPI-anchored protein that binds to new proteins and bone morphogenetic proteins (BMP2 and BMP4) and can be released from the cell membrane. HFE2 plays a key role in the regulation of hepcidin, which regulates the absorption and recycling of iron.(PMID: 17331953; PMID: 17938254)