HGD Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84931-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 84931-3-PBS against Human HGD was performed. The affinity constant is below 1 pM.

HGD Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84931-3-PBS

Clone No.242485D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

AKU, EC:1.13.11.5, HGO, Homogentisate 1,2 dioxygenase, Homogentisate 1,2-dioxygenase

---

Product Information

84931-3-PBS targets HGD in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9544

  Product name: Recombinant human HGD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-329 aa of BC020792

  Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTALRRPARSSWHLRGLPMAPWHLCLNHL

• Full Name: homogentisate 1,2-dioxygenase (homogentisate oxidase)
• Calculated Molecular Weight: 37 kDa, 50 kDa
• GenBank Accession Number: BC020792
• Gene Symbol: HGD
• Gene ID (NCBI): 3081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q93099
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.