HGD Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84931-5-RR (same clone as 84931-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84931-5-RR (HGD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84931-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 84931-5-RR (same clone as 84931-5-PBS)

  rat liver tissue lysates were subjected to SDS PAGE followed by western blot with 84931-5-RR (HGD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84931-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 84931-5-RR (same clone as 84931-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 84931-5-RR (HGD antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84931-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84931-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84931-5-RR against Human HGD were performed. The affinity constant is 1.38 nM.

HGD Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84931-5-PBS

Clone No.242485E11

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242485E11, AKU, EC:1.13.11.5, HGO, Homogentisate 1,2 dioxygenase

---

Product Information

84931-5-PBS targets HGD in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9544

  Product name: Recombinant human HGD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-329 aa of BC020792

  Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTALRRPARSSWHLRGLPMAPWHLCLNHL

• Full Name: homogentisate 1,2-dioxygenase (homogentisate oxidase)
• Calculated Molecular Weight: 37 kDa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC020792
• Gene Symbol: HGD
• Gene ID (NCBI): 3081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q93099
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Homogentisate1,2-dioxygenase (HGD), also named as HGO, is a mononuclear Fe(II)-dependent oxygenase that catalyzes the third step in the pathway for the catabolism of tyrosine, the conversion of homogentisate (HG) to maleylacetoacetate (MAA) and it can exsit as a dimer or trimer(PMID:14678794). HGD consists of a single type of subunit with no intermolecular disulfide bridges and requires Fe2+ as a cofactor(PMID: 7705358). Defects in HGD are the cause of alkaptonuria (AKU)(PMID:10594001).