Home
Products
Primary Antibodies
HGF Polyclonal antibody, PBS Only (26881-1-PBS)

Filter: AllWBIHCIF-PIF/ICC

WB analysis using 26881-1-AP (same clone as 26881-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 26881-1-AP (HGF alpha antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
WB analysis using 26881-1-AP (same clone as 26881-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 26881-1-AP (HGF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
WB analysis using 26881-1-AP (same clone as 26881-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 26881-1-AP (HGF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 26881-1-AP (same clone as 26881-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26881-1-AP (HGF alpha antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 26881-1-AP (same clone as 26881-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26881-1-AP (HGF alpha antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 26881-1-AP (same clone as 26881-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26881-1-AP (HGF Alpha antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 26881-1-AP (same clone as 26881-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26881-1-AP (HGF Alpha antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
IF Staining of human liver cancer using 26881-1-AP (same clone as 26881-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human liver cancer tissue using HGF antibody (26881-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
IF Staining of human liver cancer using 26881-1-AP (same clone as 26881-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human liver cancer tissue using HGF antibody (26881-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 26881-1-AP (same clone as 26881-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using HGF Alpha antibody (26881-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26881-1-PBS in a different storage buffer formulation.

HGF Polyclonal antibody, PBS Only

Name: HGF Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 26881-1-PBS

HGF Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 26881-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

HGF Alpha, Hepatocyte growth factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain, Hepatopoietin-A

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

26881-1-PBS targets HGF in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag25456 Product name: Recombinant human HGF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 118-157 aa of BC130286 Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP Predict reactive species
Full Name	hepatocyte growth factor (hepapoietin A; scatter factor)
Observed Molecular Weight	69 kDa
GenBank Accession Number	BC130286
Gene Symbol	HGF
Gene ID (NCBI)	3082
RRID	AB_2880668
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P14210
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Hepatocyte growth factor (HGF) is the most potent mitogen of mature hepatocytes in primary culture. HGF is derived from a biologically inactive single chain precursor of 728 amino acids (pro-HGF) localized mostly on the cell surface and in the extracellular matrix. The mature form produced following proteolytic cleavage is composed of a 69-kDa α-subunit (containing four kringle domains) and the 34 kDa β-subunit, similar to the catalytic domain of serine proteases, but with amino acid substitutions in the active site. HGF is a pleiotropic cytokine which exerts a variety of effects on several cells, being involved in the regulation of many biological processes, such as inflammation, tissue repair, morphogenesis, angiogenesis, tumour propagation, immunomodulation of viral infections and cardio-metabolic activities.