Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HGS Polyclonal antibody

HGS Polyclonal Antibody for IF/ICC

Cat No. CL488-10390

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

HGS, HRS, Protein pp110, ZFYVE8

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10390 targets HGS in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0589

Product name: Recombinant human HGS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 186-387 aa of BC003565

Sequence: GQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPS

Predict reactive species
Full Name hepatocyte growth factor-regulated tyrosine kinase substrate
Calculated Molecular Weight 86 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC003565
Gene Symbol HGS
Gene ID (NCBI) 9146
RRIDAB_3083876
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14964
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS, synonyms: HRS, ZFYVE8) is a 110 to 115-kDa zinc finger phosphotyrosine protein inducible by stimulation with interleukin 2 (IL-2), granulocyte-macrophage colony-stimulating factor (GM-CSF) as well as hepatocyte growth factor (HGF), and is associated with signal-transducing adaptor molecule (STAM). HGS suppresses DNA synthesis upon stimulation with IL-2 and GM-CSF, counteracting the function of STAM which is critical for cell growth signaling mediated by the cytokines. HGS also interacts with the neurofibromatosis 2 tumor suppressor protein schwannomin/merlin. The growth suppression activity of schwannomin/merlin requires HGS and the binding of schwannomin/merlin to HGS facilitates its ability to function as a tumor suppressor, probably by inhibiting STAT activation.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HGS antibody CL488-10390Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...