Product Information
21415-1-PBS targets HIGD2A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15892 Product name: Recombinant human HIGD2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC007502 Sequence: MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP Predict reactive species |
| Full Name | HIG1 hypoxia inducible domain family, member 2A |
| Calculated Molecular Weight | 106 aa, 12 kDa |
| Observed Molecular Weight | 11 kDa, 50 kDa |
| GenBank Accession Number | BC007502 |
| Gene Symbol | HIGD2A |
| Gene ID (NCBI) | 192286 |
| RRID | AB_2935453 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BW72 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The mammalian HIGD-family proteins include two subgroups of yeast Rcf1 homologs, HIGD1A/B/C and HIGD2A/B. HIGD1A and HIGD2A (of 10.4 and 11.5 kDa, respectively) have two hydrophilic transmembrane domains and are localized in the inner mitochondrial membrane. HIGD1A and HIGD2A expression is induced under stress conditions like hypoxia or glucose deprivation in human cervical epithelial cells and murine cerebral cortical neurons. HIGD1A may play pleiotropic roles in mitochondrial respiratory chain biogenesis. HIGD2A forms a 50 kDa regulatory module with COX4-1, COX5B, and COX6A1, which binds to newly synthesized COX3 to promote its binding to the previously assembled COX1 + COX2 module (PMID:33291261,32375044).
