HINT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HINT2 Polyclonal antibody, PBS Only (17986-1-PBS)

• 

  WB analysis using 17986-1-AP (same clone as 17986-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17986-1-AP (HINT2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17986-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 17986-1-AP (same clone as 17986-1-PBS)

  WB result of HINT2 antibody (17986-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HINT2 transfected HeLa cells. This data was developed using the same antibody clone with 17986-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 17986-1-AP (same clone as 17986-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 17986-1-AP (HINT2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17986-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 17986-1-AP (same clone as 17986-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HINT2 antibody (17986-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 17986-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HINT2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17986-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Adenosine 5'-monophosphoramidase HINT2, EC:3.9.1.-, HINT 2, HINT 3, HINT-2

---

Product Information

17986-1-PBS targets HINT2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12413

  Product name: Recombinant human HINT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC047737

  Sequence: MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG

• Full Name: histidine triad nucleotide binding protein 2
• Calculated Molecular Weight: 163 aa, 17 kDa
• Observed Molecular Weight: ~17 kDa
• GenBank Accession Number: BC047737
• Gene Symbol: HINT2
• Gene ID (NCBI): 84681
• RRID: AB_3669287
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BX68
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.