CoraLite® Plus 488-conjugated HIRA Recombinant monoclonal antibody

HIRA Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83194-5
Clone No.240006E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Protein HIRA, HIRA/HIR, HIR, 240006E5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83194-5 targets HIRA in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34439

Product name: Recombinant human HIRA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 850-1017 aa of NM_003325

Sequence: SLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK

Predict reactive species
Full Name HIR histone cell cycle regulation defective homolog A (S. cerevisiae)
Calculated Molecular Weight 112 kDa
GenBank Accession NumberNM_003325
Gene Symbol HIRA
Gene ID (NCBI) 7290
RRIDAB_3673219
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54198
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HIRA protein is encoded by a gene within a region of human chromosome 22q11.2 deleted in most patients with the DiGeorge syndrome, a developmental disorder, and was named for its amino acid sequence homology to two S. cerevisiae proteins, Hir1p and Hir2p. HIRA is critical in a specific chromatin assembly pathway that takes place independently of DNA synthesis (PMID: 12049744). HIRA complex associates with various proteins, such as transcription factors, RNA pol II, Prohibitin (PHB), and replication protein A (RPA) suggests that the targeting of the complex at specific locations may exploit additional structural properties and mechanisms (PMID: 30082790).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HIRA antibody CL488-83194-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...