Histone H1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Histone H1 Polyclonal antibody (18201-1-AP)

Histone H1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18201-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

H1, HIST1H1A, H1.1, H1-1, H1F1

• 

  WB analysis using 18201-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18201-1-AP (Histone H1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18201-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18201-1-AP (Histone H1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 18201-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 18201-1-AP (Histone H1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 18201-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 18201-1-AP (Histone H1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 18201-1-AP

  IP result of anti-Histone H1 (IP:18201-1-AP, 4ug; Detection:18201-1-AP 1:500) with mouse kidney tissue lysate 4400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 18201-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 18201-1-AP (Histone H1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Histone H1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, mouse kidney tissue, mouse lung tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18201-1-AP targets Histone H1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12704

  Product name: Recombinant human Histone H1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC101593

  Sequence: MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK

• Full Name: histone cluster 1, H1a
• Calculated Molecular Weight: 215 aa, 22 kDa
• Observed Molecular Weight: 28 kDa, 30 kDa
• GenBank Accession Number: BC101593
• Gene Symbol: Histone H1
• Gene ID (NCBI): 3024
• RRID: AB_10859820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02539
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone H1 is a key chromatin structural protein, which mediates higher-order chromatin folding. H1 is also emerging as an important epigenetic mark and regulator of gene expression and cellular differentiation.

Publications

What published studies show

The Histone H1 Polyclonal antibody (Cat# 18201-1-AP) has 12 citations published in journals including Nature Communications, Autophagy, Advanced Science, Experimental Molecular Medicine, Pharmacological Research, European Journal of Pharmacology, International Journal of Molecular Sciences, Cell Calcium, Pharmaceuticals, Scientific Reports, and bioRxiv. Research fields span viral autophagy, necroptosis in diabetic cardiomyopathy and kidney disease, glioma stem cell biology, cardiac hypertrophy, Alzheimer's neuroprotection, neuronal L1 adhesion, post-ischemic brain plasticity, VEGFA/ROS regulation, and pancreatic cancer immunosuppression.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; Pseudorabies virus gM protein and herpesvirus homologs block selective autophagy to enhance viral replication; Authors - Qiongqiong Zhou
mouse,human	IF	Nat Commun; NPM3 functions as a lactyltransferase to promote necroptosis in male diabetic cardiomyopathy mice models via FASN transcription modulation.; Authors - Hongjiao Xu
mouse	IF	Exp Mol Med; Keratin 18 functions as a lactyltransferase to trigger necroptosis in diabetic kidney disease by modulating Fas transcription.; Authors - Qiao Zhao
		Adv Sci (Weinh); Histone Lactylation-Driven Upregulation of VRK1 Expression Promotes Stemness and Proliferation of Glioma Stem Cells; Authors - Jinna Li
	WB	Pharmacol Res; YAP K236 acetylation facilitates its nucleic export and deprived the protection against cardiac hypertrophy in mice; Authors - Panxia Wang
mouse	WB	Pharmaceuticals (Basel); Integrating UHPLC-QE-MS and Bioinformatics with Experimental Validation Reveals MAPK/FOS-Mediated Podocyte Apoptosis as the Key Mechanism of Alpiniae oxyphyllae and Saposhnikovia divaricata in Treating Diabetic Kidney Disease.; Authors - Xian Wang