Histone H1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Histone H1 Polyclonal antibody, PBS Only (18201-1-PBS)

Histone H1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18201-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

H1, HIST1H1A, H1.1, H1-1, H1F1

• 

  WB analysis using 18201-1-AP (same clone as 18201-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18201-1-AP (Histone H1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18201-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18201-1-AP (same clone as 18201-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18201-1-AP (Histone H1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18201-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 18201-1-AP (same clone as 18201-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 18201-1-AP (Histone H1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18201-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 18201-1-AP (same clone as 18201-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 18201-1-AP (Histone H1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18201-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 18201-1-AP (same clone as 18201-1-PBS)

  IP result of anti-Histone H1 (IP:18201-1-AP, 4ug; Detection:18201-1-AP 1:500) with mouse kidney tissue lysate 4400ug. This data was developed using the same antibody clone with 18201-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 18201-1-AP (same clone as 18201-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 18201-1-AP (Histone H1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18201-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Histone H1 in ?

Chat with Able

---

Product Information

18201-1-PBS targets Histone H1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12704

  Product name: Recombinant human Histone H1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC101593

  Sequence: MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK

• Full Name: histone cluster 1, H1a
• Calculated Molecular Weight: 215 aa, 22 kDa
• Observed Molecular Weight: 28 kDa, 30 kDa
• GenBank Accession Number: BC101593
• Gene Symbol: Histone H1
• Gene ID (NCBI): 3024
• RRID: AB_10859820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02539
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Histone H1 is a key chromatin structural protein, which mediates higher-order chromatin folding. H1 is also emerging as an important epigenetic mark and regulator of gene expression and cellular differentiation.