HKR1 Polyclonal antibody

• 

  WB analysis of COLO 320 using 14902-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 14902-1-AP (HKR1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  WB analysis of HEK-293 using 14902-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14902-1-AP (HKR1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14902-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14902-1-AP (HKR1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 14902-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 14902-1-AP (HKR1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

HKR1 Polyclonal Antibody for WB, ELISA

Cat No. 14902-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

GLI Kruppel family member HKR1, HKR1, Protein HKR1

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14902-1-AP targets HKR1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6694

  Product name: Recombinant human HKR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 254-599 aa of BC053845

  Sequence: NLITHQRTHSGEKPYVCKDCGRGFTWKSNLFTHQRTHSGLKPYVCKECGQSFSLKSNLITHQRAHTGEKPYVCRECGRGFRQHSHLVRHKRTHSGEKPYICRECEQGFSQKSHLIRHLRTHTGEKPYVCTECGRHFSWKSNLKTHQRTHSGVKPYVCLECGQCFSLKSNLNKHQRSHTGEKPFVCTECGRGFTRKSTLSTHQRTHSGEKPFVCAECGRGFNDKSTLISHQRTHSGEKPFMCRECGRRFRQKPNLFRHKRAHSGAFVCRECGQGFCAKLTLIKHQRAHAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG

• Full Name: GLI-Kruppel family member HKR1
• Calculated Molecular Weight: 73 kDa, 75 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC053845
• Gene Symbol: HKR1
• Gene ID (NCBI): 284459
• RRID: AB_2878091
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10072
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HKR1, also named as ZNF875, belongs to the krueppel C2H2-type zinc-finger protein family. HRK1 is a modular protein that comprises a photosensory rhodopsin, a histidine kinase, a response regulator and a putative guanylyl cyclase domain. HKR1 is related to the protonation state of the Schiff base function that provides the linkage of the retinal chromophore with a Lys side chain of the protein (PMID: 25836735). HRK1 has 2 isoforms with the molecular mass of 73-75 kDa.