HLA-DMA Recombinant monoclonal antibody, PBS Only

HLA-DMA Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 82899-2-PBS
Clone No.230155E7

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

Indirect ELISA, IHC, WB

hCG_2001572, DMA protein MHC class II antigen Major histocompatibility complex, class II, DM alpha cDNA FLJ75740, highly similar to Homo sapiens major histocompatibility complex, class II, DM alpha, DMA protein, DMA, D6S222E

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82899-2-PBS targets HLA-DMA in Indirect ELISA, IHC, WB applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2452

Product name: Recombinant human HLA-DMA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-261 aa of BC026279

Sequence: LPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD

Predict reactive species
Full Name major histocompatibility complex, class II, DM alpha
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC026279
Gene Symbol HLA-DMA
Gene ID (NCBI) 3108
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ31604
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). The class II molecules are composed of two non-covalently associated alpha and beta chains. HLA-DMA and HLA-DMB form a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA-DM plays a critical role in catalyzing the release of Class II HLA-associated invariant chain-derived peptides (CLIP) from newly synthesized class II HLA molecules and freeing the peptide binding site for acquisition of antigenic peptides.

Loading...
||
New chat Able
正在加载,请稍候...