HLA-DMA Recombinant monoclonal antibody

• 

  WB analysis using 82899-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82899-2-RR (HLA-DMA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 82899-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82899-2-RR (HLA-DMA antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 82899-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82899-2-RR (HLA-DMA antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 82899-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82899-2-RR against Human HLA-DMA were performed. The affinity constant is 0.303 nM.

HLA-DMA Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 82899-2-RR

Clone No.230155E7

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

hCG_2001572, DMA protein MHC class II antigen Major histocompatibility complex, class II, DM alpha cDNA FLJ75740, highly similar to Homo sapiens major histocompatibility complex, class II, DM alpha, DMA protein, DMA, D6S222E

---

Tested Applications

• Positive WB detected in: Daudi cells, Ramos cells, Raji cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82899-2-RR targets HLA-DMA in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2452

  Product name: Recombinant human HLA-DMA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-261 aa of BC026279

  Sequence: LPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD

• Full Name: major histocompatibility complex, class II, DM alpha
• Calculated Molecular Weight: 261 aa, 29 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC026279
• Gene Symbol: HLA-DMA
• Gene ID (NCBI): 3108
• RRID: AB_3670628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q31604
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). The class II molecules are composed of two non-covalently associated alpha and beta chains. HLA-DMA and HLA-DMB form a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA-DM plays a critical role in catalyzing the release of Class II HLA-associated invariant chain-derived peptides (CLIP) from newly synthesized class II HLA molecules and freeing the peptide binding site for acquisition of antigenic peptides.