HLTF Recombinant monoclonal antibody, PBS Only

HLTF Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86362-2-PBS
Clone No.251000A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, Indirect ELISA

DNA-binding protein/plasminogen activator inhibitor 1 regulator, EC:2.3.2.27, Helicase-like transcription factor, HIP116, HIP116A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86362-2-PBS targets HLTF in WB, Indirect ELISA applications and shows reactivity with human, mouse, monkey samples.

Tested Reactivity human, mouse, monkey
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5596

Product name: Recombinant human HLTF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-354 aa of BC044659

Sequence: MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKADGLS

Predict reactive species
Full Name helicase-like transcription factor
Calculated Molecular Weight 114 kDa
Observed Molecular Weight 114 kDa
GenBank Accession NumberBC044659
Gene Symbol HLTF
Gene ID (NCBI) 6596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14527
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Helicase-like Transcription Factor (HLTF) is a crucial nuclear protein and member of the SWI/SNF family of chromatin-remodeling complexes, playing a dual role in transcription regulation and DNA damage repair. It functions dually as a regulator of gene expression, utilizing its ATP-dependent helicase activity to modify chromatin structure and facilitate transcription, and as a central effector in the DNA damage response pathway. HLTF is particularly crucial for promoting error-free DNA repair at stalled replication forks via a mechanism called template switching, which prevents the accumulation of mutagenic lesions. HLTF can be detected as 114 kDa.

Loading...
||
New chat Able
正在加载,请稍候...