HMCN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HMCN2 Polyclonal antibody, PBS Only (32178-1-PBS)

• 

  WB analysis using 32178-1-AP (same clone as 32178-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 32178-1-AP (HMCN2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32178-1-PBS in a different storage buffer formulation.

• 

  IP experiment of SH-SY5Y using 32178-1-AP (same clone as 32178-1-PBS)

  IP result of anti-HMCN2 (IP:32178-1-AP, 4ug; Detection:32178-1-AP 1:600) with SH-SY5Y cells lysate 1720 ug. This data was developed using the same antibody clone with 32178-1-PBS in a different storage buffer formulation.

HMCN2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 32178-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

Hemicentin 2 , Hemicentin-2

---

Product Information

32178-1-PBS targets HMCN2 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37696

  Product name: Recombinant human HMCN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-536 aa of XM_011518465.3

  Sequence: TLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSGKPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHEGNPLLRVSGVSYSGVAPGAPLVSMAPRIHGYLHQPLLVSCSVHSALPFRLQLRRGEARLGEERHFQESGNSSWEILRASKAEEGTYECTAVSRAGTGRAKAQIVVTDPPPQLVPAPNVTVSPGETAVLS

• Full Name: hemicentin 2
• Calculated Molecular Weight: 542kDa，5059aa
• Observed Molecular Weight: 550 kDa
• GenBank Accession Number: XM_011518465.3
• Gene Symbol: HMCN2
• Gene ID (NCBI): 256158
• RRID: AB_3742536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NDA2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HMCN2 (Hemicentin-2) is a large extracellular matrix protein belonging to the fibronectin family. HMCN2 proteins form a complex network of microfibrils in the extracellular matrix that is essential for the maintenance of tissue structure and function. HMCN2 is expressed in epithelial cells and muscle tissues, and may play an important role in muscle-tendon attachment. HMCN2 expression and localization suggests that it has an important role in maintaining the integrity of skin and muscle tissue. It may maintain tissue structure and function by interacting with other extracellular matrix proteins, such as fibronectin and elastic fibers.