HMGA2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HMGA2 Polyclonal antibody, PBS Only (20795-1-PBS)

• 

  WB analysis using 20795-1-AP (same clone as 20795-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20795-1-AP (HMGA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20795-1-AP (same clone as 20795-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20795-1-AP (HMGA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NIH/3T3 using 20795-1-AP (same clone as 20795-1-PBS)

  IP result of anti-HMGA2 (IP:20795-1-AP, 4ug; Detection:20795-1-AP 1:1000) with NIH/3T3 cells lysate 3200ug. This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 20795-1-AP (same clone as 20795-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 20795-1-AP (HMGA2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 20795-1-AP (same clone as 20795-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 20795-1-AP (HMGA2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 20795-1-AP (same clone as 20795-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20795-1-AP (HMGA2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 20795-1-AP (same clone as 20795-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20795-1-AP (HMGA2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 20795-1-AP (same clone as 20795-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using HMGA2 antibody (20795-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20795-1-AP (same clone as 20795-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using HMGA2 antibody (20795-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 20795-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HMGA2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 20795-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

High mobility group AT-hook protein 2, High mobility group protein HMGI-C, HMGI C, HMGIC

---

Product Information

20795-1-PBS targets HMGA2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14588

  Product name: Recombinant human HMGA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-109 aa of NM_003483

  Sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

• Full Name: high mobility group AT-hook 2
• Calculated Molecular Weight: 108 aa, 12 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: NM_003483
• Gene Symbol: HMGA2
• Gene ID (NCBI): 8091
• RRID: AB_2665377
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52926
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HMGA2 belongs to the family of high mobility group with AT-hook DNA binding domain. HMGA proteins are considered architectural transcription factors; they do not have direct transcriptional activation capacity, but instead regulate gene expression by changing DNA conformation through binding to AT-rich regions in the DNA and/or direct interaction with other transcription factors (PMID: 18202751,19551524). HMGA2 is abundantly and ubiquitously expressed and plays a crucial role during embryonic development (18425117). HMGA2 promotes stem cell self-renewal and research studies have shown that decreased HMGA2 expression is associated with stem cell aging (19551524). Investigators have shown that expression levels of HMGA2 are very low in normal adult tissues, while either overexpression or rearrangement is associated with many types of cancer (PMID: 20228781). The calcualted molecular weight of HMGA2 is 12 kDa, but modified HMGA2 is about 18-20 kDa. (PMID: 18505920 )