HMGB4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HMGB4 Polyclonal antibody, PBS Only (12787-1-PBS)

• 

  WB analysis of mouse testis using 12787-1-AP (same clone as 12787-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12787-1-AP (HMGB4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12787-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 12787-1-AP (same clone as 12787-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 12787-1-AP (HMGB4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12787-1-PBS in a different storage buffer formulation.

HMGB4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12787-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12787-1-PBS targets HMGB4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3503

  Product name: Recombinant human HMGB4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-186 aa of BC021180

  Sequence: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPSTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQAPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS

• Full Name: high-mobility group box 4
• Calculated Molecular Weight: 186 aa, 22 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC021180
• Gene Symbol: HMGB4
• Gene ID (NCBI): 127540
• RRID: AB_10638490
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WW32
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

High mobility group protein B4 (HMGB4) is a new member in the family of HMGB proteins. Unlike other HMGB-proteins, it is a mammalian specific protein that has two HMGB-boxes but lacks the acidic tail. HMGB4 is strongly and preferentially expressed in the adult mouse testis and weakly in the brain, but not in many other tissues (PMID: 18987332). It binds strongly to nuclear structures, regulates chromatin and mediates differentiation of neuronal cells (PMID: 27608812).