HMGCR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HMGCR Polyclonal antibody, PBS Only (13533-1-PBS)

• 

  IP experiment of HeLa using 13533-1-AP (same clone as 13533-1-PBS)

  IP result of anti-HMGCR (IP:13533-1-AP, 4ug; Detection:13533-1-AP 1:500) with HeLa cells lysate 960 ug. This data was developed using the same antibody clone with 13533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13533-1-AP (same clone as 13533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13533-1-AP (HMGCR antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13533-1-AP (same clone as 13533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13533-1-AP (HMGCR antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 13533-1-AP (same clone as 13533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13533-1-AP (HMGCR Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 13533-1-AP (same clone as 13533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13533-1-AP (HMGCR Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 13533-1-AP (same clone as 13533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 13533-1-AP (HMGCR antibody) at dilution of 1:1000 (under 10x lens).. This data was developed using the same antibody clone with 13533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 13533-1-AP (same clone as 13533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 13533-1-AP (HMGCR antibody) at dilution of 1:1000 (under 40x lens).. This data was developed using the same antibody clone with 13533-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HMGCR Polyclonal Antibody for IHC, IP, Indirect ELISA

Cat No. 13533-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IP, Indirect ELISA

Synonyms

EC:1.1.1.34, HMG CoA reductase, HMG-CoA reductase

---

Product Information

13533-1-PBS targets HMGCR in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4444

  Product name: Recombinant human HMGCR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 536-835 aa of BC033692

  Sequence: TRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA

• Full Name: 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
• Calculated Molecular Weight: 888 aa, 95 kDa
• GenBank Accession Number: BC033692
• Gene Symbol: HMGCR
• Gene ID (NCBI): 3156
• RRID: AB_2877957
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04035
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HMGCR(3-hydroxy-3-methylglutaryl-coenzyme A reductase) is also named as HMG-CoA reductase and belongs to the HMG-CoA reductase family. This protein exists as a 97-kDa glycoprotein in the endoplasmic reticulum (ER) and is the rate-determining enzyme of the biosynthesis pathway(PMID:15830340).The ectopic expression of either full-length HMGCR or its novel splice variant promotes dysregulation of the MVA pathway. And the ectopic expression of cHMGCR-FL(60 kDa) and cHMGCR-D13(55 kDa) can be detected in HepG2 cells(PMID:20696928).This protein is also can exsit as a oligomer(PMID:20696928).