HMGN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HMGN2 Polyclonal antibody, PBS Only (10953-1-PBS)

• 

  WB analysis using 10953-1-AP (same clone as 10953-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10953-1-AP (HMGN2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10953-1-AP (same clone as 10953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10953-1-AP (HMGN2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10953-1-AP (same clone as 10953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10953-1-AP (HMGN2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10953-1-AP (same clone as 10953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 10953-1-AP (HMGN2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10953-1-AP (same clone as 10953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 10953-1-AP (HMGN2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10953-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10953-1-AP (same clone as 10953-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using HMGN2 antibody (10953-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 10953-1-PBS in a different storage buffer formulation.

HMGN2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10953-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

High mobility group nucleosome-binding domain-containing protein 2, HMG17, Non-histone chromosomal protein HMG-17

---

Product Information

10953-1-PBS targets HMGN2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1401

  Product name: Recombinant human HMGN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC014644

  Sequence: MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK

• Full Name: high-mobility group nucleosomal binding domain 2
• Calculated Molecular Weight: 9 aa, 3 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC014644
• Gene Symbol: HMGN2
• Gene ID (NCBI): 3151
• RRID: AB_2118482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05204
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HMGN2 is a highly conserved nucleosomal protein which may involve in unfolding higher-order chromatin structure and facilitating the transcriptional activation of mammalian genes. It is the most abundant, ubiquitous and evolutionarily conserved nonhistione proteins found in the nuclei of higher eukaryotes. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer.