HMP19 Polyclonal antibody

• 

  IHC staining of human hepatocirrhosis using 19423-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 19423-1-AP (HMP19 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 19423-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 19423-1-AP (HMP19 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 19423-1-AP

  Immunofluorescent analysis of HepG2 cells, using HMP19 antibody 19423-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

HMP19 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 19423-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

HMP19, HMP19 protein, NSG2, Protein p19

---

Tested Applications

• Positive IHC detected in: human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19423-1-AP targets HMP19 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13751

  Product name: Recombinant human HMP19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC002619

  Sequence: MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH

• Full Name: HMP19 protein
• Calculated Molecular Weight: 171 aa, 19 kDa
• GenBank Accession Number: BC002619
• Gene Symbol: HMP19
• Gene ID (NCBI): 51617
• RRID: AB_10638444
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y328
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Int J Cancer; Suppression of pancreatic cancer growth and metastasis by HMP19 identified through genome-wide shRNA screen.; Authors - Hiroshi Kurahara