HMX2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HMX2 Polyclonal antibody, PBS Only (23160-1-PBS)

• 

  WB analysis using 23160-1-AP (same clone as 23160-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23160-1-AP (HMX2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23160-1-PBS in a different storage buffer formulation.

HMX2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23160-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

H6 family homeobox 2, H6L, Homeobox protein HMX2, Nkx5 2

---

Product Information

23160-1-PBS targets HMX2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19564

  Product name: Recombinant human HMX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC137139

  Sequence: MGSKEDAGKGCPAAGGVSSFTIQSILGGGPSEAPREPVGWPARKRSLSVSSEEEEPDDGWKAPACFCPDQHGPKEQGPKHHPPIPFPCLGTPKGSGGSGPGGLERTPFLSPSHSDFKEEKERLLPAGSPSPGSERPRDGGAERQAGAAKK

• Full Name: H6 family homeobox 2
• Calculated Molecular Weight: 273 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC137139
• Gene Symbol: HMX2
• Gene ID (NCBI): 3167
• RRID: AB_3669409
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: A2RU54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.