HMX3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HMX3 Polyclonal antibody, PBS Only (34183-1-PBS)

• 

  WB analysis using 34183-1-AP (same clone as 34183-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34183-1-AP (HMX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34183-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 34183-1-AP (same clone as 34183-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34183-1-AP (HMX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 34183-1-AP (same clone as 34183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 34183-1-AP (HMX3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34183-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 34183-1-AP (same clone as 34183-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HMX3 antibody (34183-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 34183-1-PBS in a different storage buffer formulation.

HMX3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 34183-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Homeobox protein H6 family member 3, Homeobox protein HMX3, Homeobox protein Nkx-5.1, NKX-5.1, NKX5-1

---

Product Information

34183-1-PBS targets HMX3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41398

  Product name: Recombinant human HMX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-169 aa of NM_001105574

  Sequence: GFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTPAGGHLPRPEASEKALLRDSSPASGTDRDSPEPLLKADPDHKELDS

• Full Name: H6 family homeobox 3
• Calculated Molecular Weight: 357aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_001105574
• Gene Symbol: HMX3
• Gene ID (NCBI): 340784
• RRID: AB_3743167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NHT5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

H6 family homeobox 3 (HMX3) is also named Homeobox protein H6 family member 3 and NKX-5.1. HMX3 is identified as a protein-coding gene, and diseases associated with HMX3 primarily include upper semicircular canal dehiscence and semicircular canal dehiscence syndrome (PMID: 22779713). In addition, as a transcription factor, HMX3 is involved in the regulation of nerve cell types, which is essential for the development of the inner ear and hypothalamus (PMID: 27151948, PMID: 15363417). HMX3 is lowly expressed in CRC, and HMX3 expression was negatively correlated with poor prognosis of CRC patients (PMID: 36204976).