CoraLite® Plus 488-conjugated HNRNPA1 Monoclonal antibody

HNRNPA1 Monoclonal Antibody for IF/ICC
Cat No. CL488-67844
Clone No.1A5A4

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse

Applications

IF/ICC

Helix destabilizing protein, hnRNP A1, hnRNP core protein A1, HNRNPA1, HNRPA1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67844 targets HNRNPA1 in IF/ICC applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17415

Product name: Recombinant human HNRNPA1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-320 aa of BC009600

Sequence: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF

Predict reactive species
Full Name heterogeneous nuclear ribonucleoprotein A1
Calculated Molecular Weight 34 kDa
Observed Molecular Weight34 kDa
GenBank Accession NumberBC009600
Gene Symbol HNRNPA1
Gene ID (NCBI) 3178
RRIDAB_2923800
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09651
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

In eukaryotic cells, nascent RNA polymerase II transcripts are associated in the nucleus with specific proteins to form ribonucleoprotein complexes called HNRP or 40S. Protein moiety of the HNRP particle has 6 major components called core proteins, and HNRPA1 is one of them. hnRNP A1 is a multifunctional RNA binding protein which is involved in pre-mRNA splicing, export of mature transcripts from the nucleus, mRNA turnover, and internal ribosome entry site (IRES)-mediated translation. HNRNPA1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HNRNPA1 antibody CL488-67844Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...