Tested Applications
| Positive WB detected in | mouse liver tissue, Jurkat cells |
| Positive IHC detected in | human stomach tissue, human colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25142-1-AP targets HNRNPA3 in WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, monkey, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18248 Product name: Recombinant human HNRNPA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-330 aa of BC113470 Sequence: MQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYN Predict reactive species |
| Full Name | heterogeneous nuclear ribonucleoprotein A3 |
| Calculated Molecular Weight | 378 aa, 40 kDa |
| Observed Molecular Weight | 37-40 kDa |
| GenBank Accession Number | BC113470 |
| Gene Symbol | HNRNPA3 |
| Gene ID (NCBI) | 220988 |
| RRID | AB_2879921 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51991 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HNRNPA3 also named as hnRNP A3 or heterogeneous nuclear ribonucleoprotein A3 is a 378 amino acid protein, which contains 2 RRM domains and localizes in nucleus. HNRNPA3 is a component of the spliceosome C complex and play a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HNRNPA3 antibody 25142-1-AP | Download protocol |
| IHC protocol for HNRNPA3 antibody 25142-1-AP | Download protocol |
| WB protocol for HNRNPA3 antibody 25142-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HNRNPA3 Polyclonal antibody (Cat# 25142-1-AP) has 24 citations. It appears in journals including Cell, Nature Communications, Nucleic Acids Research, EMBO Journal, International Journal of Biological Sciences, Science China Life Sciences, Arteriosclerosis Thrombosis and Vascular Biology, Cell and Molecular Life Sciences, Life Sciences, Journal of Cell Biology, Neurobiology of Disease, Noncoding RNA Research, mBio, Mediators of Inflammation, Journal of Cellular and Molecular Medicine, Poultry Science, Molecular Oncology, Journal of Cellular Biochemistry, Oncology Letters, and bioRxiv. Research fields span RNA biology, stress granules, cancer, diabetes, neurodegeneration, and virology.
| Species | Application | Title |
|---|---|---|
Nat Commun 5'tRNA-derived fragments modulate β-cell homeostasis and islet macrophage activation in type 2 diabetes. | ||
Nat Commun A network of RNA-binding proteins controls translation efficiency to activate anaerobic metabolism. | ||
Nat Commun SARS-CoV-2 N protein-induced Dicer, XPO5, SRSF3, and hnRNPA3 downregulation causes pneumonia | ||
Nucleic Acids Res Altered mRNA transport and local translation in i3Neurons with RNA-binding protein knockdown | ||
Int J Biol Sci Mannose Inhibits NSCLC Growth and Inflammatory Microenvironment by Regulating Gut Microbiota and Targeting OGT/hnRNP R/JUN/IL-8 Axis |
Reviews
What customers say
The single review (5/5) reports the antibody performs well in Western blot and immunocytochemistry on human cells, detecting a double band at ~55 kDa, with a mainly nuclear signal. It also yields a weak but specific signal in mouse spinal cord tissue by IHC. The reviewer used a 1:1000 dilution with overnight incubation at 4°C across all applications (WB, ICC, and IHC), with standard blocking and antigen retrieval protocols. Overall, the feedback is positive, highlighting reliable specificity in both human and mouse samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tatyana (Verified Customer) (01-21-2023) | Works well in ICC and WB in human cells. Also gives a weak but specific signal in the mouse CNS tissue (spinal cord). WB: 4% milk in TBST and semi-dry transfer; detects a double band at ~55kDa ICC: 5% goat serum in PBST; mainly nuclear IHC: 4% PFA fixed and paraffinised sections; standard antigen retrieval and DAB detection; mainly nuclear Used at 1:1000, with incubation overnight at 4C, in all applications
 |
