HNRNPC Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82798-3-RR (same clone as 82798-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82798-3-RR (HNRNPC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82798-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 82798-3-RR (same clone as 82798-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 82798-3-RR (HNRNPC antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82798-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 82798-3-RR (same clone as 82798-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 82798-3-RR (HNRNPC antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82798-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 82798-3-RR (same clone as 82798-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 82798-3-RR (HNRNPC antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82798-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 82798-3-RR (same clone as 82798-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 82798-3-RR (HNRNPC antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82798-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82798-3-RR (same clone as 82798-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HNRNPC antibody (82798-3-RR, Clone: 4F16 ) at dilution of 1:1000 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004). CoraLite® Plus 488-Phalloidin (green). This data was developed using the same antibody clone with 82798-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82798-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82798-3-RR against Human HNRNPC were performed. The affinity constant is below 1 pM.

HNRNPC Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 82798-3-PBS

Clone No.4F16

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HNRPC, hnRNP C1/C2, HNRNP, C2, C1

---

Product Information

82798-3-PBS targets HNRNPC in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2356

  Product name: Recombinant human HNRNPC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-293 aa of BC003394

  Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS

• Full Name: heterogeneous nuclear ribonucleoprotein C (C1/C2)
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC003394
• Gene Symbol: HNRNPC
• Gene ID (NCBI): 3183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07910
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.