HOMER2 Polyclonal antibody

• 

  WB analysis using 29282-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29282-1-AP (HOMER2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HOMER2 Polyclonal Antibody for WB, ELISA

Cat No. 29282-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ACPD, CPD, Cupidin, HOMER 2, homer homolog 2 (Drosophila)

---

Tested Applications

• Positive WB detected in: HEK-293 cells, LNCaP cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29282-1-AP targets HOMER2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29718

  Product name: Recombinant human HOMER2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 150-343 aa of BC012109

  Sequence: HLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN

• Full Name: homer homolog 2 (Drosophila)
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC012109
• Gene Symbol: HOMER2
• Gene ID (NCBI): 9455
• RRID: AB_2918267
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NSB8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.