HOXA5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HOXA5 Polyclonal antibody, PBS Only (27622-1-PBS)

• 

  WB analysis using 27622-1-AP (same clone as 27622-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27622-1-AP (HOXA5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27622-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 27622-1-AP (same clone as 27622-1-PBS)

  IP result of anti-HOXA5 (IP:27622-1-AP, 4ug; Detection:27622-1-AP 1:500) with HEK-293 cells lysate 1360 ug. This data was developed using the same antibody clone with 27622-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 27622-1-AP (same clone as 27622-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using HOXA5 antibody (27622-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 27622-1-PBS in a different storage buffer formulation.

HOXA5 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 27622-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

homeobox A5, Homeobox protein Hox 1C, Homeobox protein Hox A5, Homeobox protein Hox-1C, Homeobox protein Hox-A5

---

Product Information

27622-1-PBS targets HOXA5 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26362

  Product name: Recombinant human HOXA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 64-163 aa of BC013682

  Sequence: FGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQ

• Full Name: homeobox A5
• Calculated Molecular Weight: 270 aa, 29 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC013682
• Gene Symbol: HOXA5
• Gene ID (NCBI): 3202
• RRID: AB_3742245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20719
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HOXA5 (Homeobox A5) is a member of the homeobox gene family, which plays a crucial role in embryonic development, cell differentiation, and tissue patterning (PMID: 31159758). These genes encode transcription factors containing a conserved homeodomain that binds DNA to regulate the expression of target genes involved in morphogenesis and organogenesis.