HOXA7 Monoclonal antibody, PBS Only

• 

  WB analysis using 67112-1-Ig (same clone as 67112-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67112-1-Ig (same clone as 67112-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 67112-1-Ig (same clone as 67112-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67112-1-Ig (same clone as 67112-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SMMC-7721 using 67112-1-Ig (same clone as 67112-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67112-1-Ig (same clone as 67112-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 67112-1-Ig (same clone as 67112-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67112-1-Ig (same clone as 67112-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67112-1-Ig (same clone as 67112-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67112-1-Ig (HOXA7 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67112-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HOXA7 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67112-1-PBS

Clone No.2A7H6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

2A7H6, ANTP, Homeobox protein Hox-1A, Homeobox protein Hox-A7, HOX1

---

Product Information

67112-1-PBS targets HOXA7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19025

  Product name: Recombinant human HOXA7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-110 aa of BC148692

  Sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALH

• Full Name: homeobox A7
• Calculated Molecular Weight: 230 aa, 25 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC148692
• Gene Symbol: HOXA7
• Gene ID (NCBI): 3204
• RRID: AB_2882416
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P31268
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HOX genes play a fundamental role in the development of the vertebrate central nervous system, heart, axial skeleton, limbs, gut, urogenital tract and external genitalia. The homeobox gene Hoxa-1 is transcriptionally regulated by retinoic acid (RA) and encodes a transcription factor, which has been shown to play important roles in cell differentiation and embryogenesis. Hoxa-1 is also expressed in cancers, such as mammary tumors, though it is not expressed in normal gland or in precancerous mammary tissues. At embryonic stages, Hoxa-2 is expressed in the mesenchyme and epithelial cells of palate, however its expression is restricted to the tips of the growing palatal shelves. Hoxa-2 protein is predominantly expressed in the nuclei of cells in the ventral mantle region of the developing embryo. In the developing and adult mouse spinal cord, Hoxa-2 protein may contribute to dorsal-ventral patterning and/or to the specification of neuronal phenotype. Hoxa-7 functions as a potent transcriptional repressor and its action as such requires several domains, including both activator and repressor regions. Hoxa-7 is expressed in the fetal liver, lung, skeletal muscle, kidney, pancreas and placenta.