HOXB4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HOXB4 Polyclonal antibody, PBS Only (22256-1-PBS)

• 

  WB analysis of Jurkat using 22256-1-AP (same clone as 22256-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 22256-1-AP (HOXB4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22256-1-PBS in a different storage buffer formulation.

HOXB4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22256-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

22256-1-PBS targets HOXB4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17761

  Product name: Recombinant human HOXB4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-72 aa of BC049204

  Sequence: EYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRDPG

• Full Name: homeobox B4
• Calculated Molecular Weight: 251 aa, 28 kDa
• Observed Molecular Weight: 28-35 kDa
• GenBank Accession Number: BC049204
• Gene Symbol: HOXB4
• Gene ID (NCBI): 3214
• RRID: AB_2879050
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17483
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.