Product Information
31387-1-PBS targets HOXB8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34946 Product name: Recombinant human HOXB8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 15-134 aa of NM_024016 Sequence: TGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQL Predict reactive species |
| Full Name | homeobox B8 |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | NM_024016 |
| Gene Symbol | HOXB8 |
| Gene ID (NCBI) | 3218 |
| RRID | AB_3742424 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P17481 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
HOXB8, also known as homeobox B8, is a member of the homeobox family. HOXB8 plays a role in the regulation of embryonic development. It helps determine the identity and differentiation of cells along the anterior-posterior axis of the body. ncreased expression of HOXB8 is associated with colorectal cancer. It has been found to enhance the proliferation and metastasis of colorectal cancer cells by promoting epithelial-mesenchymal transition (EMT) via STAT3 activation (PMID: 30622439).





