HOXB8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HOXB8 Polyclonal antibody, PBS Only (31387-1-PBS)

• 

  WB analysis using 31387-1-AP (same clone as 31387-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31387-1-AP (HOXB8 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31387-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31387-1-AP (same clone as 31387-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31387-1-AP (HOXB8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31387-1-PBS in a different storage buffer formulation.

HOXB8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31387-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Hox 2.4, HOX2D

---

Product Information

31387-1-PBS targets HOXB8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34946

  Product name: Recombinant human HOXB8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-134 aa of NM_024016

  Sequence: TGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQL

• Full Name: homeobox B8
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_024016
• Gene Symbol: HOXB8
• Gene ID (NCBI): 3218
• RRID: AB_3742424
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P17481
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HOXB8, also known as homeobox B8, is a member of the homeobox family. HOXB8 plays a role in the regulation of embryonic development. It helps determine the identity and differentiation of cells along the anterior-posterior axis of the body. ncreased expression of HOXB8 is associated with colorectal cancer. It has been found to enhance the proliferation and metastasis of colorectal cancer cells by promoting epithelial-mesenchymal transition (EMT) via STAT3 activation (PMID: 30622439).