HPGD Monoclonal antibody, PBS Only

• 

  WB analysis using 66798-1-Ig (same clone as 66798-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66798-1-Ig (HPGD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human small intestine using 66798-1-Ig (same clone as 66798-1-PBS)

  human small intestine tissue were subjected to SDS PAGE followed by western blot with 66798-1-Ig (HPGD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66798-1-Ig (same clone as 66798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66798-1-Ig (same clone as 66798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66798-1-Ig (same clone as 66798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66798-1-Ig (same clone as 66798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66798-1-Ig (same clone as 66798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66798-1-Ig (same clone as 66798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 66798-1-Ig (same clone as 66798-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using 66798-1-Ig (HPGD antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 66798-1-Ig (same clone as 66798-1-PBS)

  1X10^6 A549 cells were intracellularly stained with 0.2 ug Anti-Human HPGD (66798-1-Ig, Clone:3F1F5) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66798-1-PBS in a different storage buffer formulation.

HPGD Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66798-1-PBS

Clone No.3F1F5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

15 PGDH, 15-hydroxyprostaglandin dehydrogenase [NAD(+)], 15-PGDH, 3F1F5, EC:1.1.1.-, EC:1.1.1.232

---

Product Information

66798-1-PBS targets HPGD in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1499

  Product name: Recombinant human HPGD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-266 aa of BC018986

  Sequence: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

• Full Name: hydroxyprostaglandin dehydrogenase 15-(NAD)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC018986
• Gene Symbol: HPGD
• Gene ID (NCBI): 3248
• RRID: AB_2861358
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15428
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HPGD, also named as PGDH (15-hydroxyprostaglandin dehydrogenase), a prostaglandin-degrading enzyme that physiologically antagonizes COX-2 (PMID:15574495). HPGD inhibits in vivo proferation of colon cancer cells (PMID:24760190). HPGD has five isoforms with the molecular mass of 29, 21, 19, 16 and 15 kDa.