HPGD Monoclonal antibody

• Home
• Products
• Primary Antibodies
• HPGD Monoclonal antibody (66798-1-Ig)

HPGD Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66798-1-Ig Copied!

Clone No. 3F1F5

Publications (8)

Reviews (1)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

15 PGDH, 15-hydroxyprostaglandin dehydrogenase [NAD(+)], 15-PGDH, 3F1F5, EC:1.1.1.-, EC:1.1.1.232

• 

  WB analysis using 66798-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66798-1-Ig (HPGD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human small intestine using 66798-1-Ig

  human small intestine tissue were subjected to SDS PAGE followed by western blot with 66798-1-Ig (HPGD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 66798-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 66798-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66798-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66798-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66798-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66798-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66798-1-Ig (HPGD antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 66798-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using 66798-1-Ig (HPGD antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of A549 using 66798-1-Ig

  1X10^6 A549 cells were intracellularly stained with 0.2 ug Anti-Human HPGD (66798-1-Ig, Clone:3F1F5) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HPGD in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COLO 320 cells, human small intestine tissue, Caco-2 cells, HT-29 cells, human colon tissue
• Positive IHC detected in: human colon tissue, human colon cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells
• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 ul suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66798-1-Ig targets HPGD in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1499

  Product name: Recombinant human HPGD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-266 aa of BC018986

  Sequence: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

• Full Name: hydroxyprostaglandin dehydrogenase 15-(NAD)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC018986
• Gene Symbol: HPGD
• Gene ID (NCBI): 3248
• RRID: AB_2861358
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15428
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HPGD, also named as PGDH (15-hydroxyprostaglandin dehydrogenase), a prostaglandin-degrading enzyme that physiologically antagonizes COX-2 (PMID:15574495). HPGD inhibits in vivo proferation of colon cancer cells (PMID:24760190). HPGD has five isoforms with the molecular mass of 29, 21, 19, 16 and 15 kDa.

Publications

What published studies show

Able is busy answering your previous question. Please try again later.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Nat Chem Biol; ENO1 promotes liver carcinogenesis through YAP1-dependent arachidonic acid metabolism; Authors - Linchong Sun ; KD Validated
rat	WB	Front Immunol; Disc inflammation and intercellular communication in shaping the immune microenvironment of intervertebral disc degeneration.; Authors - Mengcheng Wei
human	WB,IHC	Mol Med Rep; GPM6B inhibits tumor progression by targeting HPGD in lung adenocarcinoma; Authors - Yonghuai Li
		Biochim Biophys Acta Mol Basis Dis; Key module genes in proximal tubular cells drive microenvironmental chronic inflammation and fibrosis in diabetic kidney disease: A single-cell transcriptomic study.; Authors - Wenjing Zhou
human	WB,IHC,IF	Biochim Biophys Acta Mol Basis Dis; Targeting 15-PGDH/15-oxoETE to mitigate inflammation and senescence in asthma.; Authors - Hongxia Bao ; KD Validated
human	WB,IHC	Reprod Sci; Progressively Diminished Prostaglandin E2 Signaling in Concordance with Increasing Fibrosis in Ectopic Endometrium; Authors - Yunhua Yi

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this antibody is a 5-star rating from a Western Blot application at 1:1000 dilution on human monocyte-derived macrophage lysate. The reviewer noted that three bands appeared, with the ~27 kD band corresponding to the specific signal. Overall, the antibody performed well for detecting the target in macrophage samples.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Huajun (Verified Customer) (09-11-2023)

Three bands show up for my human macrophage lysate when doing WB. ~27kD band will be the specific signal.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: human monocyte derived macrophage

HPGD Antibody Western Blot validation (1:1000 dilution) in human monocyte derived macrophage (Cat no:66798-1-Ig)