HPGDS Recombinant monoclonal antibody

• 

  WB analysis of human placenta using 85446-2-RR

  human placenta tissue were subjected to SDS PAGE followed by western blot with 85446-2-RR (HPGDS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 85446-2-RR

  Biolayer interferometry (BLl) kinetic assays of 85446-2-RR against Human HPGDS were performed. The affinity constant is 0.168 nM.

HPGDS Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85446-2-RR

Clone No.242980B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.5.1.18, EC:5.3.99.2, Glutathione S transferase, Glutathione S-transferase, Glutathione-dependent PGD synthase

---

Tested Applications

• Positive WB detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85446-2-RR targets HPGDS in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18290

  Product name: Recombinant human PGDS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC020734

  Sequence: MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

• Full Name: prostaglandin D2 synthase, hematopoietic
• Calculated Molecular Weight: 199 aa, 23 kDa
• Observed Molecular Weight: 26 kDa, 52 kDa
• GenBank Accession Number: BC020734
• Gene Symbol: HPGDS
• Gene ID (NCBI): 27306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60760
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hematopoietic PGD synthase (HPGDS), one of the PGD2 synthases, is distributed in the cytoplasm of mast cells and Th2 cells and catalyzes PGD2 production during inflammation and allergic reactions. HPGDS belongs to the gene family of σ-type glutathione S-transferase (GST). Like other GSTs, it exists as a homodimer in vivo with a molecular weight of approximately 52 kDa (PMID: 38339125).