CoraLite® Plus 488-conjugated HPRT Monoclonal antibody

• 

  IF Staining of HeLa using CL488-67518

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 HPRT antibody (CL488-67518, Clone: 1C3D1 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

HPRT Monoclonal Antibody for IF/ICC

Cat No. CL488-67518

Clone No.1C3D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

HPRT1, Hypoxanthine-guanine phosphoribosyltransferase, HGPRTase, HGPRT, EC:2.4.2.8

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67518 targets HPRT in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7044

  Product name: Recombinant human HPRT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-218 aa of BC000578

  Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

• Full Name: hypoxanthine phosphoribosyltransferase 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC000578
• Gene Symbol: HPRT1
• Gene ID (NCBI): 3251
• RRID: AB_2919488
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P00492
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout. 67518-1-Ig antibody detects the protein around 28 kDa in SDS-PAGE. And HPRT1 deficient cell line Sp2/0 was served as a negative control in PTG's results.(PMID:20544509, 28045594, 27379977)