• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HPRT Monoclonal antibody

HPRT Monoclonal Antibody for IF/ICC
Cat No. CL488-67518
Clone No.1C3D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

HPRT1, Hypoxanthine-guanine phosphoribosyltransferase, HGPRTase, HGPRT, EC:2.4.2.8

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67518 targets HPRT in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7044

Product name: Recombinant human HPRT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-218 aa of BC000578

Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Predict reactive species
Full Name hypoxanthine phosphoribosyltransferase 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC000578
Gene Symbol HPRT1
Gene ID (NCBI) 3251
RRIDAB_2919488
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00492
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout. 67518-1-Ig antibody detects the protein around 28 kDa in SDS-PAGE. And HPRT1 deficient cell line Sp2/0 was served as a negative control in PTG's results.(PMID:20544509, 28045594, 27379977)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HPRT antibody CL488-67518Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...